68173
75
Verklein
Vergroot
Pagina terug
1/103
Pagina verder
(max.20characters.Thenentertheseparatemacrocommands.
Amacro’s command stringis limited to 26 characters. Each com
-
mand or button simulation consists of two characters. You can
therefore only link a maximum of 13 commands together, or, for
example,join 7 commands/ key strokesimulationswith afurther
12 digits.
Commands and keys for macro programming
A macro consists of various commands, orecall flash button strokes, that are compiled into one command sequence
and stored under a defined direct dialing key. When this function key is pressed, the individual commands
contained in the macro are executed one after the other.
The following commands are available for macro programming:
»B« Initiatingacall(sameasliftingthehandset)
»D« Endingacall(sameasreplacingthehandset)
»ELSE« Alternativecommand,ifarequiredcondition(e.g. »IFLA«oIFLB«)isnotfulfilled.
»IFLA«
»IFLB«
ExecutethismacroonlywhentheLEDforthefirstlevelisoffIFLA«)orflashesIFLB«). Ifthiscondition
isnotfulfilledtheprocedureisdiscontinued,orresumedafterthecommand»ELSE«(whereavailable).
»K« Keypadsequence;allofthefollowingcharacters/digitsaretransmittedasakeypadsequence.
»LA« DeactivateLED
»LB« TheLEDflashes
»LE« ActivateLED
»LZ« ActivateLEDfortwoseconds
»n« Dummynumber.
Ifanumber is enteredprior to executionof a macro(orfor example,dialed fromthe telephone) thisnum-
berisusedinplaceofthedummynumberinthemacro.
»P« Pause(1second)inthecommandsequence(betweentwocharacters/commands)
»RE« Re-establishthephone’sidlestate.
Ifthereisanactiveconnectionatthisphone,executionofthismacroiscanceledatthis point.
»SE« Activatingthespeaker(normalvolume)
»SA« Activatingthespeaker(lowvolume)
»T« DTMF-Sequenz:allofthefollowingcharacters/digitsaretransferredasDTMFdialing.
»TS« Testingaconnection.
If there is currently no connection active, or an outgoing connection can not be set up (for B. subscriber
busy),executionofthemacroiscanceledatthispoint.
If you wish to incorporate a telephone key into a macro, press the corresponding key during macro programming
(this is indicated, for example by » s5« in the display). All keys used for operating the telephone during macro
programming (e. g. save, change entry position, delete entry or cancel) cannot be incorporated into the macro by
simply actuating them, but need to be linked with the macro by means of the following commands.
»c« ActuationoftheC-button.
»esc« ActuationoftheESC-button.
»f« Actuationofthemenubutton.
»« Actuationoftheleftarrowbutton.
Programming numbers
71
75

Hulp nodig? Stel uw vraag in het forum

Spelregels

Misbruik melden

Gebruikershandleiding.com neemt misbruik van zijn services uitermate serieus. U kunt hieronder aangeven waarom deze vraag ongepast is. Wij controleren de vraag en zonodig wordt deze verwijderd.

Product:

Bijvoorbeeld antisemitische inhoud, racistische inhoud, of materiaal dat gewelddadige fysieke handelingen tot gevolg kan hebben.

Bijvoorbeeld een creditcardnummer, een persoonlijk identificatienummer, of een geheim adres. E-mailadressen en volledige namen worden niet als privégegevens beschouwd.

Spelregels forum

Om tot zinvolle vragen te komen hanteren wij de volgende spelregels:

Belangrijk! Als er een antwoord wordt gegeven op uw vraag, dan is het voor de gever van het antwoord nuttig om te weten als u er wel (of niet) mee geholpen bent! Wij vragen u dus ook te reageren op een antwoord.

Belangrijk! Antwoorden worden ook per e-mail naar abonnees gestuurd. Laat uw emailadres achter op deze site, zodat u op de hoogte blijft. U krijgt dan ook andere vragen en antwoorden te zien.

Abonneren

Abonneer u voor het ontvangen van emails voor uw Funkwerk CS410 bij:


U ontvangt een email met instructies om u voor één of beide opties in te schrijven.


Ontvang uw handleiding per email

Vul uw emailadres in en ontvang de handleiding van Funkwerk CS410 in de taal/talen: Engels als bijlage per email.

De handleiding is 0,9 mb groot.

 

U ontvangt de handleiding per email binnen enkele minuten. Als u geen email heeft ontvangen, dan heeft u waarschijnlijk een verkeerd emailadres ingevuld of is uw mailbox te vol. Daarnaast kan het zijn dat uw internetprovider een maximum heeft aan de grootte per email. Omdat hier een handleiding wordt meegestuurd, kan het voorkomen dat de email groter is dan toegestaan bij uw provider.

Stel vragen via chat aan uw handleiding

Stel uw vraag over deze PDF

loading

Uw handleiding is per email verstuurd. Controleer uw email

Als u niet binnen een kwartier uw email met handleiding ontvangen heeft, kan het zijn dat u een verkeerd emailadres heeft ingevuld of dat uw emailprovider een maximum grootte per email heeft ingesteld die kleiner is dan de grootte van de handleiding.

Er is een email naar u verstuurd om uw inschrijving definitief te maken.

Controleer uw email en volg de aanwijzingen op om uw inschrijving definitief te maken

U heeft geen emailadres opgegeven

Als u de handleiding per email wilt ontvangen, vul dan een geldig emailadres in.

Uw vraag is op deze pagina toegevoegd

Wilt u een email ontvangen bij een antwoord en/of nieuwe vragen? Vul dan hier uw emailadres in.



Info